PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA06G0089700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 171aa    MW: 19353.9 Da    PI: 11.4716
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA06G0089700.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.2e-163883348
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +WT+eEd  l ++  ++G+++W+++a+ m+ +R++ qc++rw+++l
  ORGLA06G0089700.1 38 AWTPEEDAVLERLAMEHGSRHWRRVAAQMPRRRSPAQCRDRWRDHL 83
                       7******************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.5113187IPR017930Myb domain
SMARTSM007172.0E-123585IPR001005SANT/Myb domain
SuperFamilySSF466894.3E-1836138IPR009057Homeodomain-like
PfamPF002492.4E-153883IPR001005SANT/Myb domain
CDDcd001674.15E-123883No hitNo description
Gene3DG3DSA:1.10.10.604.7E-183894IPR009057Homeodomain-like
SMARTSM00717188144IPR001005SANT/Myb domain
PROSITE profilePS500905.6891142IPR017877Myb-like domain
PfamPF139216.1E-592143No hitNo description
Gene3DG3DSA:1.10.10.601.0E-495141IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MDMEFSSSSS SSSTTVASSP ASSPPLGRCV LRFRLPPAWT PEEDAVLERL AMEHGSRHWR  60
RVAAQMPRRR SPAQCRDRWR DHLARDVFHR PFTVADDAEL ARLCLRLDDD AGFAAGRRWK  120
DVSRAVYGRS SCAVKRRWRE LRRSDAFLGA LWRPRTTTTA PPANAAITTT C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3osf_A2e-154013815103MYB21
3osf_D2e-154013815103MYB21
3osg_A2e-154013815103MYB21
3osg_D2e-154013815103MYB21
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0046510.0AP004651.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0091G06.
GenBankAP0051070.0AP005107.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0431E05.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642261.11e-105PREDICTED: transcription factor MYB44-like
TrEMBLI1Q1841e-119I1Q184_ORYGL; Uncharacterized protein
STRINGORGLA06G0089700.11e-118(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83601346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.14e-13myb domain protein 73